Download free
sliced meat on white ceramic plate beside orange fruit
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Food & Drink

sliced meat on white ceramic plate beside orange fruit

Snickers cake (vegan) Please for more check my instagram @briivegan

A map markerLondon, London, United Kingdom
Calendar outlinedPublished on CameraCanon, EOS 2000D
SafetyFree to use under the Unsplash License
londonunited kingdomFood images & picturesCake imagesvegansnickersveganismplantsweetsconfectionerybreadHd orange wallpapersFruits images & picturescitrus fruitproducemealdishfrench toasttoastpotteryPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Food
242 images · Curated by Ahmet Sali
Food images & picturesdrinkdessert