– –– ––––
––– – ––– – –– –– ––––
––– – ––– – –silhouette of trees during sunset
Download this free HD photo of landscapes, wildlife, kenya, and wild by Ahmed Galal (@ahmadgalal)
Landscape images & pictureswildlifekenyawildahmedgalalsunset cloudmaasai mara national reservewild animalSunset images & picturesHd landscape wallpaperslandscape naturemaasai marakenyan safariwildlife photographyfieldLandscape images & picturesHd sky wallpapersTree images & picturesplantHd scenery wallpapersPublic domain images
Browse premium related images on iStock | Save 20% with code UNSPLASH20
Related collections
African Landscape
18 images · Curated by Rebecca Pavlik
CSP Possible Images
20 images · Curated by Debbie Willis
Wanderfull Website Image Base
899 images · Curated by Raphaelle Gasse
