Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Klemen Vrankar's profile
Klemen Vrankar
klemenvrankar
Edit image Plus sign for Unsplash+
Download free
silhouette of man looking at milky way
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos

silhouette of man looking at milky way

What a night

A map markerSlovenia
Calendar outlinedPublished on January 21, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
wallpaperspaceblacknight skynightgalaxystarshopemilky waysilhouettecosmosviewastrophotographymilkywaynightskyhillsideheavensnightscapebackgroundstarPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20