Download free
several vehicle parked beside building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

several vehicle parked beside building

Download this free HD photo of car, urban, road, and automobile in NYC, USA by Taylor Rooney (@rooney)

A map markerThe High Line , NYC, USA
Calendar outlinedPublished on CameraApple, iPhone 7 Plus
SafetyFree to use under the Unsplash License
Car images & picturesurbanroadautomobiletransportationvehiclebuildingtownHd city wallpapersPeople images & picturesfreewaytarmacasphalthighwayhigh riseapartment buildingtowerspirearchitecturesteeplePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Foreboding
68 images · Curated by Robert Milos
forebodingHd wallpapersHq background images
Spring
246 images · Curated by Wendy Heeder
Spring images & picturesplantFlower images