Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Scott Webb's profile
Scott Webb
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
selective focus photography of pink petaled flower
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos

selective focus photography of pink petaled flower

A lot of trees are flowering right now and I had to stop to take a couple of photographs against that blue sky.

Calendar outlinedPublished on May 18, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
flowerspringminimalist wallpapernaturalpinkgreyminimalistminimalfloralsimple wallpaperblossomsimpleminimalismplain backgroundsimple backgroundsky bluepetalbloomminimalist backgroundbranchPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20