Download free
road inside forest
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

road inside forest

Download this free HD photo of road, street, nature, and wallpaper by Agung Raharja (@agungraharja)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5300
SafetyFree to use under the Unsplash License
roadstreetNature imagesHd wallpapersvscoviewsindonesiaHd grey wallpapersasphalttarmacfreewayhighwaydirt roadgravelPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Up
29 images · Curated by Naoufal Kadhom
upbuildingarchitecture