Download free
road between trees
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

road between trees

Download this free HD photo of telluride, united states, road, and woodland in Telluride, United States by Kyle Cesmat (@kylecesmat)

A map markerTelluride, United States
Calendar outlinedPublished on CameraFUJIFILM, X100S
SafetyFree to use under the Unsplash License
tellurideunited statesroadwoodlandHd forest wallpapersTree images & picturesHd snow wallpapersjourneyroadtripwindingStreetSunset images & picturesmountain rangeduskTree images & picturesHd grey wallpapershighwayfreewaygraveldirt roadPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Composer
1,806 images · Curated by composer
composereducationBook images & photos