Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Jesse Echevarria's profile
Jesse Echevarria
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
road and buildings
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos

road and buildings

Walking through New York on a busy day.

A map markerManhattan, New York, United States
Calendar outlinedPublished on January 30, 2018 (UTC)SafetyFree to use under the Unsplash License
carcitybuildingarchitectureroadnew yorkstreettruckurbanvehiclecityscapeskyscrapertrafficflagtowermanhattanfujifilmcommuteconcrete junglegreyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20