Download free
red leaf trees near red building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

red leaf trees near red building

Download this free HD photo of mandi, red leaf, red background, and landscapes by Rishabh Dharmani (@rishabhdharmani)

Calendar outlinedPublished on CameraSONY, ILCE-6500
SafetyFree to use under the Unsplash License
mandired leafRed backgroundsLandscape images & picturesroad signred leavesbridgesred treeroads from aboveroadred treesplantTree images & picturesmaplepathtarmacasphaltwalkwaytransportationvehiclePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Long Exposure
671 images · Curated by Rowan Heuvel
long exposurerockoutdoor