Download free
red and yellow signage on street
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

red and yellow signage on street

Download this free HD photo of urban, building, city, and town by James Boey (@james_boey)

Calendar outlinedPublished on CameraLeica Camera AG, LEICA M10
SafetyFree to use under the Unsplash License
urbanbuildingHd city wallpaperstownstreetPeople images & pictureshumanmetropolisalleysidewalktarmacasphaltwheelmachinespokealloy wheelvehicletransportationtextHd brick wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

family
110 images · Curated by Aaron Booth
Family images & photoschildHd kids wallpapers
Cityscape
147 images · Curated by Jesse Belleque
cityscapebuildingHd city wallpapers