Download free
body of water
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

body of water

Download this free HD photo of sea, ocean, wave, and foam by Victoria Kurtovich (@victoria_kurto)

Calendar outlinedPublished on CameraCanon, EOS 600D
SafetyFree to use under the Unsplash License
seaHd ocean wallpapersHd wave wallpapersfoamHd water wallpapersoutdoorsNature imageswafecrestwetspraysplashcoastBeach images & picturesHd grey wallpapersHd wave wallpapersrough seascrestsHd dark wallpaperssea wavesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Romantics
66 images · Curated by Judith Jung
romanticHd grey wallpapersplant
Oceans and River
12 images · Curated by Paulo Henrique
riverseaoutdoor
wave
8 images · Curated by k lisoo
Hd wave wallpaperswafesea