Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of cafe, human, person, and pedestrian in Athens, Greece by Daria Nepriakhina πŸ‡ΊπŸ‡¦ (@epicantus)

A map markerAthens, Greece
Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
cafehumanPeople images & picturespedestrianpathfurniturechairtransportationvehiclebikebicyclewalkwaypavementsidewalkclothingfootwearshoecoatovercoattarmacPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Cities with ambiance
198 images Β· Curated by Daria Nepriakhina πŸ‡ΊπŸ‡¦
Hd city wallpapersbuildingStreet
Greece
90 images Β· Curated by Daria Nepriakhina πŸ‡ΊπŸ‡¦
greeceHd blue wallpapersrock
Old town - old city in photo
1,459 images Β· Curated by Fons Heijnsbroek
phototownHd city wallpapers