Download free
woman standing on sidewalk while holding book and smartphone
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

woman standing on sidewalk while holding book and smartphone

Download this free HD photo of women who work, simplicity, flatlay and desk by Marissa Grootes (@stilclassis)

Calendar outlinedPublished on CameraSONY, ILCE-7M2
SafetyFree to use under the Unsplash License
women who worksimplicityflatlaydeskplanner loveplanner nerdPaper backgroundsplannerpaper goodsfashionintentional livingdesk vibespantsjeansbikebicyclecoatjacketelectronicsovercoatPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

SOCIAL MEDIA 2
631 photos · Curated by Lauren O'Malley
socialHd grey wallpapersplant
IWI Planner
36 photos · Curated by ANNE PHILI
planneragendaHd grey wallpapers