Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Alexander Grey's profile
Alexander Grey
sharonmccutcheon
Edit image Plus sign for Unsplash+
Download free
photo of woman's face reflection
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

People

photo of woman's face reflection

A close up macro shot of two girls with blue eyes. These girls are my two eldest daughters. I shot this using available natural light from a south facing window.

A map markerOgden, United States
Calendar outlinedPublished on January 18, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
portraitpeoplefamilymodelfacepinkeyegirlslifestylevisionreflectionirissisterspiercingblue eyetwinsoftnessportraiture2018mimicPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20