Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Person
Get Unsplash+Log in
Go to Priscilla Du Preez 🇨🇦's profile
Priscilla Du Preez 🇨🇦
priscilladupreez
Edit image Plus sign for Unsplash+
Download free
people laughing and talking outside during daytime
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos, Spirituality

people laughing and talking outside during daytime

Download this free HD photo of woman, people, women, and happy by Priscilla Du Preez 🇨🇦 (@priscilladupreez)

Calendar outlinedPublished on April 6, 2017 (UTC)CameraSafetyFree to use under the Unsplash License
womanpeoplewomenhappysmilefriendtalkingfriendshipsocialyouthtalkhatsmilingsunnylaughlaughterperson wallpaperhappy wallpaperevent wallpaperplayfulPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20