Download free
low-angle photography of people on yellow playground equipment
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

low-angle photography of people on yellow playground equipment

Download this free HD photo of cedar point, sandusky, united states, and vacation in Sandusky, United States by Aaron Burden (@aaronburden)

A map markerCedar Point, Sandusky, United States
Calendar outlinedPublished on CameraPanasonic, DMC-GX1
SafetyFree to use under the Unsplash License
cedar pointsanduskyunited statesvacationSummer images & picturesthrill seekerPeople images & picturesfairgroundstructurebuildingarchitectureplaymachinecarnivalparkadrenalineoutsideHd blue wallpapersHd yellow wallpaperscolourPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Adventurous
24 images · Curated by Jordan
adventurouadventureoutdoor
Zábavní parky
8 images · Curated by Lucie Zakopalová
amusement parkfunroller coaster