Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of johannesburg, south africa, open, and blue in Johannesburg, South Africa by Mpho Mojapelo (@mpho_mojapelo)

A map markerJohannesburg, South Africa
Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
johannesburgsouth africaopenHd blue wallpapersHd sky wallpaperssteelglasschimneyreflectionHd windows wallpapersbuildingHd city wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Picture in picture
23 images · Curated by Tim Gouw
picturehandHd phone wallpapers
Travel
593 images · Curated by Lauren Hopkins
Travel imagesoutdoorhuman