Download free
yellow and gray asphalt road
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

yellow and gray asphalt road

Download this free HD photo of brown, road, asphalt, and tarmac by Adolfo Félix (@adolfofelix)

Calendar outlinedPublished on CameraCanon, EOS 70D
SafetyFree to use under the Unsplash License
Brown backgroundsroadasphalttarmachighwayfreewaygraveldirt roadNature imagesTree images & picturesplantoutdoorspathPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Table View
39 images · Curated by Alison Costa
tablecupFood images & pictures
Heart
40 images · Curated by Trending Collections
Heart imagesvalentineValentines day images