Download free
people walking on sidewalk near body of water during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

people walking on sidewalk near body of water during daytime

Download this free HD photo of on, burlington, road, and person in Burlington, Canada by Carol-Ann Wodehouse (@dexie195)

A map markerBurlington, ON, Canada
Calendar outlinedPublished on CameraApple, iPhone 11
SafetyFree to use under the Unsplash License
onburlingtonroadPeople images & pictureshumanbicyclevehiclebiketransportationfreewaytarmacasphalthighwaypathbuildingwaterfrontHd water wallpapersurbanHd city wallpaperstownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Explore Yosemite Park
60 images · Curated by Luke Chesser
exploreparkyosemite
City Life
45 images · Curated by Mike Tannenbaum
Life images & photosHd city wallpapersbuilding
Emotions
20 images · Curated by Alyona Smorodnikova
emotionPeople images & pictureshuman