Download free
a person riding a motorcycle on a mountain road
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

a person riding a motorcycle on a mountain road

Download this free HD photo of road, nature, human, and person by Isaac Mitchell (@isaactmitchell)

Calendar outlinedPublished on CameraCanon, EOS 90D
SafetyFree to use under the Unsplash License
roadNature imageshumanPeople images & picturesoutdoorsslopehighwayfreewayasphalttarmacpromontoryHd scenery wallpapersvehicletransportationMountain images & pictureshelmetMotorcycle pictures & imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Nature
1,672 images · Curated by Ali huraira
Nature imagesoutdoorCloud pictures & images
2LC
46 images · Curated by Danica Mitchell
2lcHd grey wallpapershuman