Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Sunrise over the mountains in Death Valley

A map markerDeath Valley National Park, United States
Calendar outlinedPublished on CameraApple, iPhone XS Max
SafetyFree to use under the Unsplash License
Nature imagesoutdoorsroadgraveldirt roadunited statesdeath valley national parkslopecountrysideasphalttarmacfreewayhighwaysoilgrasslandfieldDesert imagessandPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Still Waters
120 images · Curated by Sharon Scott
still waterlakereflection