Download free
motorcycle on road
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

motorcycle on road

Download this free HD photo of crete, malia, grey, and road in Malia, Crete by Camille Brodard (@kmile_ch)

A map markerMalia, Crete
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D7200
SafetyFree to use under the Unsplash License
cretemaliaHd grey wallpapersroadgreecemotobikersouthHd holiday wallpapersvehicletransportationautomobileCar images & pictureshumanPeople images & picturesfreewayasphalttarmachighwaycar mirrorPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Collection #116: Chuck Hughes
10 images · Curated by Chuck Hughes
outdoorHd wallpapersshoe
tools & objects
406 images · Curated by manu schwendener
objecttoolWebsite backgrounds