Download free
medium-coated white dog on brown brick ground
– –––– –.
––– – ––– –––
– –––– –.
––– – ––– –––

medium-coated white dog on brown brick ground

Download this free HD photo of dog, grey, cute, and autumn by Elisei Abiculesei (@elisei97)

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
Dog Images & PicturesHD Grey WallpapersCute Images & PicturesHD Autumn WallpapersbichonwalkfriendfriendsHD White WallpapersEye ImagesFriendship ImagesAnimals Images & PicturescaninemammalpetpathwalkwayhumanPeople Images & PicturesterrierPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20