Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Timo Stern's profile
Timo Stern
timonrets
Edit image Plus sign for Unsplash+
Download free
man standing on mountain range near body of water
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

man standing on mountain range near body of water

Download this free HD photo of wallpaper, travel, portrait, and sea in Formentor, Mallorca by Timo Stern (@timonrets)

A map markerFormentor, Mallorca
Calendar outlinedPublished on December 18, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
wallpapertravelportraitseagreenlovefreecouplephotographyphotovintagelakeviewwildsimplicitysonywandererhumanlandgreyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20