Download free
man riding blue bicycle
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

man riding blue bicycle

Worker in Kyoto Japan

Calendar outlinedPublished on CameraFUJIFILM, X-T1
SafetyFree to use under the Unsplash License
bicyclebikemalemanstreetroadsignurbanHd city wallpapersbuildinghumanPeople images & picturesPeople images & picturesvehicletransportationpavementpathsidewalkwalkwayperformerPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

vintage photos
70 images · Curated by Aleksandra Stachowicz
photoVintage backgroundshuman
SOTA
13 images · Curated by Jessica Banninga
sotumhumanPeople images & pictures
Content writing
46 images · Curated by Nissa Abdillah
humanclothingapparel