Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to engin akyurt's profile
engin akyurt
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
man in gray robe using laptop computer
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Current Events

man in gray robe using laptop computer

coronavirus

A map markerTurkey
Calendar outlinedPublished on March 30, 2020 (UTC)CameraSafetyFree to use under the Unsplash License
womangirlpeoplehumanfacefemalewhitegreymaskchinesesafevirusconceptcautioncoronaviruscoronasymptoms2020spreadingcomputerPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20