Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to engin akyurt's profile
engin akyurt
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
man in brown crew neck t-shirt
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

man in brown crew neck t-shirt

mad man

A map markerTurkey
Calendar outlinedPublished on May 11, 2020 (UTC)CameraSafetyFree to use under the Unsplash License
portraitmanpeoplehumanmodelfaceskinhandsmeneyeshairmalelipsposearmlookmadholdposingblackPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20