Download free
man in black jacket driving red convertible car
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial
HQ Background Images › App Backgrounds › Zoom Backgrounds

man in black jacket driving red convertible car

Joey | Angeles National Forest

A map markerAngeles National Forest, California, USA
Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
usaangeles national foresthumanPeople images & picturesvehicleautomobileCar images & picturestransportationaccessoryaccessoriessunglassesmachinewheeldrivingfacephotoportraitphotographysports carselfiePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Cars
320 images · Curated by Aga Olej
Car images & picturesvehicletransportation
Cars
104 images · Curated by C J
Car images & picturesvehicleautomobile