Download free
man in black crew neck t-shirt and gray denim jeans wearing black and white vr
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

man in black crew neck t-shirt and gray denim jeans wearing black and white vr

Los Angeles Dodgers — World Champions!

A map markerSanta Barbara, CA, USA
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D850
SafetyFree to use under the Unsplash License
bornraisedfantextl.a.lalos angelescity of angelsCalifornia pictureswalkingBaseball imagesjblfanaticspeakerwalksidewalktypographyfontPeople images & picturesdenimPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20