Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Usman Yousaf's profile
Usman Yousaf
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
man in black crew neck shirt wearing black framed eyeglasses
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

man in black crew neck shirt wearing black framed eyeglasses

A man wearing mask looking downwards black and white

Calendar outlinedPublished on January 16, 2021 (UTC)CameraSafetyFree to use under the Unsplash License
portraitmanfaceroomhealthcaremaleyoung manmaskhealth carefiltervirusflucoronavirusillnessviralsicknessepidemicfluecovid-19humanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20