Download free
man carrying backpack walking on mountain at daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

man carrying backpack walking on mountain at daytime

Having completed the Thorung La pass it was all downhill to Muktinath, Nepal

A map markerMuktinath, Nepal
Calendar outlinedPublished on CameraNIKON, COOLPIX P7700
SafetyFree to use under the Unsplash License
travellingtrekkingtravelingHd sky wallpaperstrailrunningvalley lightwater bottleoutsidesalomonacclimatizationtrekkerCloud pictures & imagesvalleytrekerwalkerpeaksvalleyscloudyHd nike wallpapersdown we goPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

MHB
42 images · Curated by Simi Schuchert
mhboutdoorhiking
Go Trekking
713 images · Curated by Santiago Narvaez
trekkingoutdoorhuman
Hiking - Approved
55 images · Curated by Jo Rodway
hikingoutdoorhuman