Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Ahmet Yüksek ✪'s profile
Ahmet Yüksek ✪
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
Majestic mountain range with a river and autumn forest.
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Majestic mountain range with a river and autumn forest.

Serene River Valley at Dusk

Calendar outlinedPublished on January 14, 2026 (UTC)CameraSafetyFree to use under the Unsplash License
forestrivertransportationcountrysidemountain rangecloudy skymountain landscapevalleymountain peakrailwaywildernesstwilighttravel destinationlandscape photographydusk skyautumn treesmountain valleyscenic viewtree linenatural environmentPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20