Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Jennifer Latuperisa-Andresen's profile
Jennifer Latuperisa-Andresen
fraumuksch
Edit image Plus sign for Unsplash+
Download free
macro photography of elephant's face
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos, Animals

macro photography of elephant's face

Experience: walk with the elephants. How about hugging an elephant? No problem at Stanley’s Camp at the Tip of Chief’s Island in the Okavango Delta in Botswana.

A map markerChief's Island, Botswana
Calendar outlinedPublished on December 20, 2016 (UTC)SafetyFree to use under the Unsplash License
textureportraitanimalblueanimal wallpapergreywildlifeeyeskinelephantsafarielephant wallpaperwildwildernesswrinkleseyelashwild lifewrinkleelephant skinweatheredPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20