Download free
a close up of the side of a military plane
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a close up of the side of a military plane

Download this free HD photo of sc, woodruff, mary hanna road, and usa in Woodruff, United States by Stephanie Klepacki (@sklepacki)

A map markerTriple Tree Aerodrome (SC00), Mary Hanna Road, Woodruff, SC, USA
Calendar outlinedPublished on CameraApple, iPhone 8 Plus
SafetyFree to use under the Unsplash License
scwoodruffmary hanna roadusatriple tree aerodrome (sc00)Hd blue wallpapersaircraftmilitarywarwar planearmy air corpswwiiww2planemilitary aircraftadvertisementbillboardtransportationvehicletextPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Travel the World
174 images · Curated by Katie Moum
Travel imageshumanbuilding
Spring Tones 🌸
120 images · Curated by Unsplash Archive
Spring images & picturesFlower imagesblossom