Download free
low angle photography of a brown house
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

low angle photography of a brown house

Uppark House, Petersfield

A map markerUppark House and Garden, South Harting, United Kingdom
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D4S
SafetyFree to use under the Unsplash License
uppark house and gardenHd windows wallpapersmistfogHd sky wallpaperstilepaneglassframechimneyrooftoproofHouse imagesSmoke backgroundsHd brick wallpaperstowerbeaconbuildingLighthouse pictures & imagesarchitecturePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Real estate
13 images · Curated by Natasha Smith
real estateHouse imageshome
l i m b o
59 images · Curated by Mesake Finau
Hd grey wallpapersoutdoorHouse images