Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Nik Shuliahin 💛💙's profile
Nik Shuliahin 💛💙
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
low angle photo of flag of U.S.A
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

low angle photo of flag of U.S.A

One of warm October days in New York City.

A map markerNew York, United States
Calendar outlinedPublished on October 19, 2017 (UTC)CameraSafetyFree to use under the Unsplash License
citybuildingarchitecturestarsstreeturbanusaglassmetalamericaskyscraperwindflagbrickbricksdaystripesnationalstars and stripesnew yorkPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20