Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Halanna Halila's profile
Halanna Halila
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
long-fur white and black cat
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

long-fur white and black cat

Joy

A map markerAmsterdam, Netherlands
Calendar outlinedPublished on February 13, 2018 (UTC)CameraSafetyFree to use under the Unsplash License
wallpapergirlcatportraitbluehomewhitewhite wallpapergreyeyeskittensimplelight bluewhite catsweetkittyblue eyesfluffywhite kittenburmesePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20