Download free
a dirt road in the middle of a green field
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a dirt road in the middle of a green field

Download this free HD photo of road, storm cloud, alberta canada, and haile by Ric Matkowski (@matkowrs)

Calendar outlinedPublished on CameraCanon, EOS 7D
SafetyFree to use under the Unsplash License
roadstorm cloudalberta canadahaileprairiesleading linesNature imagesoutdoorspathHd sky wallpapersBrown backgroundstarmacasphaltfreewayhighwayhorizongraveldirt roadPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Collection #149: Grovemade
8 images · Curated by Grovemade
grovemadeworkoffice
SPACECAPADES
1,053 images · Curated by Susan H.
spacecapadeStar imagesHd wallpapers
Portrait Mode
345 images · Curated by Mihir Sumant
portraitplantoutdoor