Download free
landscape photo of walk pathway lined with trees
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

landscape photo of walk pathway lined with trees

While on a video shoot, grabbed some shots to supplement the video.

A map markerFriendswood, USA
Calendar outlinedPublished on CameraCanon, EOS 5D Mark III
SafetyFree to use under the Unsplash License
Hd green wallpapersfriendswooddriveTree images & picturestree linedpeacecalmpathtrailsidewalkpavementroadasphalttarmacplantGrass backgroundswalkwaysunlightoutdoorsTree images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

pathways-benches
15 images · Curated by Linda Palmer
pathways-benchoutdoorplant