Download free
person riding bicycle beside road
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

person riding bicycle beside road

Download this free HD photo of car, urban, city, and building by Nastya Dulhiier (@dulhiier)

Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
Car images & picturesurbanHd city wallpapersbuildingbicyclebikesidewalkpathwalkwayvehicletransportationautomobilepavementhumanpedestrianPeople images & picturesmetropolistowncobblestoneoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Blurrrr
388 images · Curated by Tim Mossholder
blurrrr회색식물