Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of foster city, california windsurfing, united states, and boating in Foster City, United States by Noah Rosenfield (@noah2199)

A map markerCalifornia Windsurfing, Foster City, United States
Calendar outlinedPublished on CameraMotorola, XT1254
SafetyFree to use under the Unsplash License
foster citycalifornia windsurfingunited statesboatingrowfoggyHd water wallpaperscalmpeacekayaklakegrayBeautiful pictures & imagescanoingcanoeboatrowingkayakingHd blue wallpapersmanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Minimal
799 images · Curated by Shawna Zylenko
minimaloutdoorHq background images
Peace II
221 images · Curated by Shawna Zylenko
peaceSunset images & picturessunrise