Download free
man and woman walking on empty road
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

man and woman walking on empty road

Download this free HD photo of person, human, path, and road by Yoav Aziz (@yoavaziz)

Calendar outlinedPublished on CameraOLYMPUS CORPORATION, E-M10 Mark III
SafetyFree to use under the Unsplash License
People images & pictureshumanpathroadurbanwalkwaywheelmachineasphalttarmacvehiclebicycleHd city wallpapersmetropolistownsidewalkpavementintersectionPeople images & picturesoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Earth & Planets
141 images · Curated by Nicole Gladding
planetEarth images & picturesHd wallpapers
Fog and Mist
108 images · Curated by Wilfried Santer
mistfogCloud pictures & images
Valentine's Day
81 images · Curated by Unsplash+ Collections
valentineRose imagesFlower images