Download free
white and black concrete building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

white and black concrete building

Download this free HD photo of n.l., monterrey, méxico, and grey in Monterrey, México by Asdrubal luna (@infectedluna)

A map markerMonterrey, N.L., México
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
n.l.monterreyMexico pictures & imagesHd grey wallpapersarquitecturaHd abstract wallpapersarchitecturebwminimalarchaircraftvehicletransportationovercoatapparelsuitcoatclothingbanisterhandrailPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Architecture
722 images · Curated by Roosa Kilpinen
architectureHd grey wallpapersstair
city
316 images · Curated by William Bernardo
Hd city wallpaperscostruzionesfondo