Download free
gray concrete building during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

gray concrete building during daytime

Download this free HD photo of grey, road, building, and office building by Erik Mclean (@introspectivedsgn)

Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadbuildingoffice buildingmetropolisHd city wallpapersurbantownhighwayfreewayasphalttarmacarchitecturesignsymbolroad signstreetintersectionmachinePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

All Nations
212 images · Curated by Aaron Burden
la personneHumainpersonne
Water
194 images · Curated by Nikia Shaw
Hd water wallpapersoutdoorsea
Devices
38 images · Curated by ThemeMountain
deviceApple images & photostechnology