Go to Clem Onojeghuo's profile
Available for hireA checkmark inside of a circle
Download free
selective photography sawdust on plank
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial
A map markerHatfield, United Kingdom
Calendar outlinedPublished on CameraCanon, EOS 5D Mark II
SafetyFree to use under the Unsplash License

Wood Work Bench This woodworking image is currently owned by Sawinery.net

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related tags

carvingunited kingdomhatfieldshavingswoodworkshavingcraftingcraftmanshipcraftsmanwood workwood shavingcurlmakercrafting woodwood craftingsandoldwarmcurlscurlyPublic domain images

Related collections

66
14 photos · Curated by Demian LaVigne
66Hd grey wallpaperswork