Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to John's profile
John
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
group of kids having a conversation near body of water
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

group of kids having a conversation near body of water

I wish I had a cool story, but I was cliff jumping with some family friends and decided to snap a pic!

Calendar outlinedPublished on June 22, 2017 (UTC)CameraSafetyFree to use under the Unsplash License
peopleseafamilygreyfriendslakekidsgirlschildrenrockfuncontrastsittinglong hairhigh contrastsandalshanging outkids hanging outsummerkidPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20