Download free
green trees on white snow covered ground during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

green trees on white snow covered ground during daytime

Download this free HD photo of arizona, granite basin lake, usa, and road in United States by Nicole Geri (@nicolegeri)

A map markerGranite Basin Lake, Arizona, USA
Calendar outlinedPublished on CameraSONY, ILCE-7M3
SafetyFree to use under the Unsplash License
arizonagranite basin lakeusaroadsnow meltingHd grey wallpapersplantTree images & picturesabiesfirconiferdirt roadgravelasphalttarmacfreewayhighwayoutdoorspinevegetationPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Contemplative
152 images · Curated by Sam Littlefair
contemplativeplantPeople images & pictures