Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Annie Spratt's profile
Annie Spratt
anniespratt
Edit image Plus sign for Unsplash+
Download free
green trees on green grass field during daytime
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

green trees on green grass field during daytime

Download this free HD photo of forest, green, autumn, and fall by Annie Spratt (@anniespratt)

Calendar outlinedPublished on September 21, 2020 (UTC)CameraSafetyFree to use under the Unsplash License
forestgreenautumnfallleavespathgreenerytrackwoodlandartlandpaintingplantgrasssceneryoutdoorswildernesstrailvegetationgrovePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20