Download free
green and black bicycle helmet on bicycle handle bar
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Health & Wellness

green and black bicycle helmet on bicycle handle bar

a green bike helmet is waiting for the next trip

A map marker83209 Prien am Chiemsee, Deutschland
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5600SafetyFree to use under the Unsplash License
83209 prien am chiemseedeutschlandwellnessapparelclothinghelmetbicyclebiketransportationvehiclecyclingsafetywallpaperbackgroundprotectioncolorfulbike helmetmachinewheelhumanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20