Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Daniel Eledut's profile
Daniel Eledut
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
grayscale photo of monoplane
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

grayscale photo of monoplane

Travelair airplane

A map markerAérodrome Jean-Baptiste Salis, Cerny, France
Calendar outlinedPublished on July 19, 2019 (UTC)CameraSafetyFree to use under the Unsplash License
blackairplanewhitegreyplaneaviationaircraftpilotpilotsandcarhumanlogoboatfrancevehicletransportationsymbolmachinehelicopterPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20